Native Mouse Albumin Protein (Azide free)
Beta LifeScience
SKU/CAT #: BLA-11637P
Native Mouse Albumin Protein (Azide free)
Beta LifeScience
SKU/CAT #: BLA-11637P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P07724 |
Synonym | alb ALBU_HUMAN Albumin (32 AA) Albumin (AA 34) cell growth inhibiting protein 42 DKFZp779N1935 GIG20 GIG42 Growth inhibiting protein 20 growth-inhibiting protein 20 OTTHUMP00000220436 OTTHUMP00000220438 OTTHUMP00000220439 PRO0883 PRO0903 PRO1341 PRO1708 PRO2044 PRO2619 PRO2675 Serum albumin UNQ696/PRO1341 |
Description | Native Mouse Albumin Protein (Azide free) is native.. It is a Full length protein |
Source | Native |
AA Sequence | EAHKSEIAHRYNDLGEQHFKGLVLIAFSQYLQKCSYDEHAKLVQEVTDFA KTCVADESAANCDKSLHTLFGDKLCAIPNLRENYGELADCCTKQEPERNE CFLQHKDDNPSLPPFERPEAEAMCTSFKENPTTFMGHYLHEVARRHPYFY APELLYYAEQYNEILTQCCAEADKESCLTPKLDGVKEKALVSSVRQRMKC SSMQKFGERAFKAWAVARLSQTFPNADFAEITKLATDLTKVNKECCHGDL LECADDRAELAKYMCENQATISSKLQTCCDKPLLKKAHCLSEVEHDTMPA DLPAIAADFVEDQEVCKNYAEAKDVFLGTFLYEYSRRHPDYSVSLLLRLA KKYEATLEKCCAEANPPACYGTVLAEFQPLVEEPKNLVKTNCDLYEKLGE YGFQNAILVRYTQKAPQVSTPTLVEAARNLGRVGTKCCTLPEDQRLPCVE DYLSAILNRVCLLHEKTPVSEHVTKCCSGSLVERRPCFSALTVDETYVPK EFKAETFTFHSDICTLPEKEKQIKKQTALAELVKHKPKATAEQLKTVMDD FAQFLDTCCKAADKDTCFSTEGPNLVTRCKDALA |
Molecular Weight | 66 kDa |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Binds water, Ca(2+), Na(+), K(+), fatty acids, hormones, bilirubin and drugs. Its main function is the regulation of the colloidal osmotic pressure of blood. Major zinc transporter in plasma, typically binds about 80% of all plasma zinc. Major calcium and magnesium transporter in plasma, binds approximately 45% of circulating calcium and magnesium in plasma. Potentially has more than two calcium-binding sites and might additionally bind calcium in a non-specific manner. The shared binding site between zinc and calcium at residue Asp-273 suggests a crosstalk between zinc and calcium transport in the blood. The rank order of affinity is zinc > calcium > magnesium. Binds to the bacterial siderophore enterobactin and inhibits enterobactin-mediated iron uptake of E.coli from ferric transferrin, and may thereby limit the utilization of iron and growth of enteric bacteria such as E.coli. Does not prevent iron uptake by the bacterial siderophore aerobactin. |
Subcellular Location | Secreted. |
Protein Families | ALB/AFP/VDB family |
Database References | |
Tissue Specificity | Plasma. Expressed in the granular cells within the cerebellum. |
Gene Functions References
- findings suggest that HMGB1 induces the transcytosis of albumin via RAGE-dependent Src phosphorylation and Cav-1 phosphorylation. These studies revealed a new mechanism of HMGB1-induced endothelial hyperpermeability. PMID: 27572515
- Urinary L-FABP, NGAL, Kim-1 and albumin levels increased during the acute phase of kidney injury and were significantly correlated with the degree of tubulointerstitial fibrosis during the chronic phase. These markers could detect higher risk of progression to CKD. PMID: 27028054
- Extending serum half-life of albumin by engineering neonatal Fc receptor (FcRn) binding. PMID: 24652290
- We provide evidence of a transcytosis within the kidney tubular system that protects albumin and IgG from lysosomal degradation, allowing these proteins to be recycled intact. PMID: 23970123
- albumin may play a distinct role in adipocyte differentiation by promoting lipid accumulation. PMID: 20529675
- No binding of albumin was observed at physiological pH to neonatal Fc receptor. At acidic pH, a 100-fold difference in binding affinity was observed. PMID: 20018855
- Cellular oxidant stress and advanced glycation endproducts of albumin: caveats of the dichlorofluorescein assay PMID: 11913966
- albumin enhancer/promoter was succesfully used for trasient transfection of fluorescent gene reporters (for cell sorting) in ES spontaneously differentiated into hepatocytes. PMID: 18942772